Recombinant Human AADAC protein, GST-tagged

  • Check with publisher
  • Published date: April 28, 2025
    • United States

Species : Human
Source : E.coli
Tag : GST
Protein Length : 24-96 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
AA Sequence : PDNVEEPWRMMWINAHLKTIQNLATFVELLGLHHFMDSFKVVGSFDEVPPTSDENVTVTETKFNNILVRVYVP
https://www.creativebiomart.net/recombinant-human-aadac-protein-gst-tagged-527551.htm

Result 0 votes
Caroline Green
0 votes

Useful information

  • Avoid scams by acting locally or paying with PayPal
  • Never pay with Western Union, Moneygram or other anonymous payment services
  • Don't buy or sell outside of your country. Don't accept cashier cheques from outside your country
  • This site is never involved in any transaction, and does not handle payments, shipping, guarantee transactions, provide escrow services, or offer "buyer protection" or "seller certification"

Related listings

  • Recombinant Rat AADAC Protein, His (Fc)-Avi-tagged

    Recombinant Rat AADAC Protein, His (Fc)-Avi-tagged

    Reagents - Supplies (United States ) April 28, 2025 Check with publisher

    Species : Rat Source : HEK293 Tag : Avi&Fc&His Endotoxin : < 1.0 EU per μg of the protein as determined by the LAL method Purity : ≥85% by SDS-PAGE Stability : Stable for at least 6 months from the date of receipt of the product under prop...

  • Recombinant Human AADAC protein, His-tagged

    Recombinant Human AADAC protein, His-tagged

    Reagents - Supplies (United States ) April 28, 2025 Check with publisher

    Species : Human Source : E.coli Tag : His Protein Length : 24-96 aa Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilizati...

  • Recombinant Mouse AADAC Protein, His (Fc)-Avi-tagged

    Recombinant Mouse AADAC Protein, His (Fc)-Avi-tagged

    Reagents - Supplies (United States ) April 28, 2025 Check with publisher

    Species : Mouse Source : HEK293 Tag : Avi&Fc&His Endotoxin : < 1.0 EU per μg of the protein as determined by the LAL method Purity : ≥85% by SDS-PAGE Stability : Stable for at least 6 months from the date of receipt of the product under pr...